PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID NNU_003189-RA
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; stem eudicotyledons; Proteales; Nelumbonaceae; Nelumbo
Family CO-like
Protein Properties Length: 493aa    MW: 54476.1 Da    PI: 6.7697
Description CO-like family protein
Gene Model
Gene Model ID Type Source Coding Sequence
NNU_003189-RAgenomeCASView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1zf-B_box17.77.4e-061244335
       zf-B_box  3 erkCpeHeekelqlfCedCqqllCedClleeHk 35
                      C+ ++e+ + l+C+ ++  lC  C  + H+
  NNU_003189-RA 12 GIPCDFCNEQIAVLYCRADSAKLCLFCDHHVHS 44
                   568**************************9995 PP

2zf-B_box22.81.9e-075599341
       zf-B_box  3 erkCpeHeekelqlfCedCqqllCedClleeHkg......Htvvp 41
                    ++C++++++++ + C +++  lC++C    H +      H++ p
  NNU_003189-RA 55 SQICDNCSSEPAPIRCSTDNLVLCQECDWDAHGNcsisasHERNP 99
                   579*************************99996688888888776 PP

3CCT62.61.2e-21441485145
            CCT   1 ReaallRYkeKrktRkFeKkirYesRKavAesRpRvKGrFvkqae 45 
                    R +a+lRYkeK+k+R+++K+irYesRKa+A+ R+RvKGrFvk++e
  NNU_003189-RA 441 RGNAMLRYKEKKKSRRYDKHIRYESRKARADARKRVKGRFVKASE 485
                    7789**************************************975 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS501199.5991057IPR000315B-box-type zinc finger
SMARTSM003365.6E-91057IPR000315B-box-type zinc finger
CDDcd000211.47E-61345No hitNo description
PROSITE profilePS5011910.0453100IPR000315B-box-type zinc finger
CDDcd000212.25E-557100No hitNo description
SMARTSM003360.5658100IPR000315B-box-type zinc finger
PfamPF062031.5E-15441483IPR010402CCT domain
PROSITE profilePS5101714.763441483IPR010402CCT domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0005622Cellular Componentintracellular
GO:0005515Molecular Functionprotein binding
GO:0008270Molecular Functionzinc ion binding
Sequence ? help Back to Top
Protein Sequence    Length: 493 aa     Download sequence    Send to blast
MEKNPRLTNS EGIPCDFCNE QIAVLYCRAD SAKLCLFCDH HVHSANALSR KHLRSQICDN  60
CSSEPAPIRC STDNLVLCQE CDWDAHGNCS ISASHERNPL ESFSGCPSAT ELASVWGFDL  120
GDKKSLMPLP PSQLSQDNHM FPSWSALDSV VSVDSWVYKY APVTLHDLMS PNENGPPLYP  180
SVPSAEIPAL SKRQNSNCGK QTQVIFKQLV ELLKRDLVSG DGVVDELGPG TPGRTTQPGN  240
IEALDLPDGG DVVADTNQLL QQQTPFTSLL MLPARLDPRE SNRLIEDNIM WDCNPTDQAA  300
QIWDFNLGKS RNHEEAGPLE VRYGSSNAGF IIKSYNDLIK GTSLTAKKVV DDIYEMNWFM  360
THDDISSQNN NSNNLAASQG PTTSESNNIP VLRASSSSTL AKPKACGNSK DAHFLKQSLL  420
VSSETARAAT KADMEMVAQN RGNAMLRYKE KKKSRRYDKH IRYESRKARA DARKRVKGRF  480
VKASEALNAE RNS
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1471477ARKRVKG
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_010249152.10.0PREDICTED: zinc finger protein CONSTANS-LIKE 14-like
TrEMBLF6I1P20.0F6I1P2_VITVI; Putative uncharacterized protein
STRINGVIT_01s0146g00360.t010.0(Vitis vinifera)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G33500.12e-94B-box type zinc finger protein with CCT domain